Lineage for d2egma1 (2egm A:8-57)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642181Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 2642182Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 2642212Family g.43.1.0: automated matches [254230] (1 protein)
    not a true family
  6. 2642213Protein automated matches [254519] (2 species)
    not a true protein
  7. 2642214Species Human (Homo sapiens) [TaxId:9606] [255143] (2 PDB entries)
  8. 2642216Domain d2egma1: 2egm A:8-57 [241756]
    Other proteins in same PDB: d2egma2
    automated match to d2dida1
    complexed with zn

Details for d2egma1

PDB Entry: 2egm (more details)

PDB Description: solution structure of the zf-b_box domain from human tripartite motif protein 41
PDB Compounds: (A:) Tripartite motif-containing protein 41

SCOPe Domain Sequences for d2egma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egma1 g.43.1.0 (A:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl

SCOPe Domain Coordinates for d2egma1:

Click to download the PDB-style file with coordinates for d2egma1.
(The format of our PDB-style files is described here.)

Timeline for d2egma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2egma2