| Class g: Small proteins [56992] (98 folds) |
| Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) ![]() |
| Family g.43.1.0: automated matches [254230] (1 protein) not a true family |
| Protein automated matches [254519] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255143] (2 PDB entries) |
| Domain d2egma1: 2egm A:8-57 [241756] Other proteins in same PDB: d2egma2 automated match to d2dida1 complexed with zn |
PDB Entry: 2egm (more details)
SCOPe Domain Sequences for d2egma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2egma1 g.43.1.0 (A:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl
Timeline for d2egma1: