![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) ![]() |
![]() | Family g.43.1.0: automated matches [254230] (1 protein) not a true family |
![]() | Protein automated matches [254519] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255143] (1 PDB entry) |
![]() | Domain d2egma_: 2egm A: [241756] automated match to d2dida1 complexed with zn |
PDB Entry: 2egm (more details)
SCOPe Domain Sequences for d2egma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2egma_ g.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgtpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl
Timeline for d2egma_: