Lineage for d2egma_ (2egm A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1706859Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 1706860Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 1706890Family g.43.1.0: automated matches [254230] (1 protein)
    not a true family
  6. 1706891Protein automated matches [254519] (1 species)
    not a true protein
  7. 1706892Species Human (Homo sapiens) [TaxId:9606] [255143] (1 PDB entry)
  8. 1706893Domain d2egma_: 2egm A: [241756]
    automated match to d2dida1
    complexed with zn

Details for d2egma_

PDB Entry: 2egm (more details)

PDB Description: solution structure of the zf-b_box domain from human tripartite motif protein 41
PDB Compounds: (A:) Tripartite motif-containing protein 41

SCOPe Domain Sequences for d2egma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egma_ g.43.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl

SCOPe Domain Coordinates for d2egma_:

Click to download the PDB-style file with coordinates for d2egma_.
(The format of our PDB-style files is described here.)

Timeline for d2egma_: