SCOPe 2.08: Domain d2egma1: 2egm A:8-57

Lineage for d2egma1 (2egm A:8-57)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
   zinc-bound alpha+beta motif

4. Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families)

5. Family g.43.1.0: automated matches [254230] (1 protein)
   not a true family

6. Protein automated matches [254519] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255143] (2 PDB entries)

8. Domain d2egma1: 2egm A:8-57 [241756]
   Other proteins in same PDB: d2egma2
   automated match to d2dida1
   complexed with zn

Details for d2egma1

PDB Entry: 2egm

PDB Description: solution structure of the zf-b_box domain from human tripartite motif protein 41

PDB Compounds: (A:) Tripartite motif-containing protein 41

SCOPe Domain Sequences for d2egma1:

Sequence; same for both SEQRES and ATOM records:

>d2egma1 g.43.1.0 (A:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpgrgsrvtdqgicpkhqealklfcevdeeaicvvcresrshkqhsvvpl

Timeline for d2egma1:

• d2egma1 first appeared in SCOPe 2.04, called d2egma_
  
• d2egma1 appears in SCOPe 2.07