Lineage for d2efdb_ (2efd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872977Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. 2872996Domain d2efdb_: 2efd B: [241753]
    automated match to d2gcob_

Details for d2efdb_

PDB Entry: 2efd (more details), 3 Å

PDB Description: Ara7/AtVps9a
PDB Compounds: (B:) Small GTP-binding protein-like

SCOPe Domain Sequences for d2efdb_:

Sequence, based on SEQRES records: (download)

>d2efdb_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

Sequence, based on observed residues (ATOM records): (download)

>d2efdb_ c.37.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy
rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt
yaqenglffmetsaktatnvkeifyeiarrlp

SCOPe Domain Coordinates for d2efdb_:

Click to download the PDB-style file with coordinates for d2efdb_.
(The format of our PDB-style files is described here.)

Timeline for d2efdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2efdd_