Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.0: automated matches [254229] (1 protein) not a true family |
Protein automated matches [254518] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255142] (1 PDB entry) |
Domain d2eela_: 2eel A: [241752] automated match to d1f2ri_ |
PDB Entry: 2eel (more details)
SCOPe Domain Sequences for d2eela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eela_ d.15.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgparpfrvsnhdrssrrgvmasslqelisktldalviatglvtlvleedgtvvd teeffqtlgdnthfmilekgqkwmpsgpssg
Timeline for d2eela_: