Lineage for d2eela_ (2eel A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638613Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1638690Family d.15.2.0: automated matches [254229] (1 protein)
    not a true family
  6. 1638691Protein automated matches [254518] (2 species)
    not a true protein
  7. 1638692Species Human (Homo sapiens) [TaxId:9606] [255142] (1 PDB entry)
  8. 1638693Domain d2eela_: 2eel A: [241752]
    automated match to d1f2ri_

Details for d2eela_

PDB Entry: 2eel (more details)

PDB Description: solution structure of the cide-n domain of human cell death activator cide-a
PDB Compounds: (A:) Cell death activator CIDE-A

SCOPe Domain Sequences for d2eela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eela_ d.15.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgparpfrvsnhdrssrrgvmasslqelisktldalviatglvtlvleedgtvvd
teeffqtlgdnthfmilekgqkwmpsgpssg

SCOPe Domain Coordinates for d2eela_:

Click to download the PDB-style file with coordinates for d2eela_.
(The format of our PDB-style files is described here.)

Timeline for d2eela_: