SCOPe 2.08: Domain d2eela1: 2eel A:8-85

Lineage for d2eela1 (2eel A:8-85)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.0: automated matches [254229] (1 protein)
   not a true family

6. Protein automated matches [254518] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255142] (1 PDB entry)

8. Domain d2eela1: 2eel A:8-85 [241752]
   Other proteins in same PDB: d2eela2, d2eela3
   automated match to d1f2ri_

Details for d2eela1

PDB Entry: 2eel

PDB Description: solution structure of the cide-n domain of human cell death activator cide-a

PDB Compounds: (A:) Cell death activator CIDE-A

SCOPe Domain Sequences for d2eela1:

Sequence; same for both SEQRES and ATOM records:

>d2eela1 d.15.2.0 (A:8-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
parpfrvsnhdrssrrgvmasslqelisktldalviatglvtlvleedgtvvdteeffqt
lgdnthfmilekgqkwmp

Timeline for d2eela1:

• d2eela1 first appeared in SCOPe 2.04, called d2eela_
  
• d2eela1 appears in SCOPe 2.07