SCOPe 2.07: Domain d2eeaa1: 2eea A:8-115

Lineage for d2eeaa1 (2eea A:8-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin b [141025] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries)
   Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192

8. Domain d2eeaa1: 2eea A:8-115 [241744]
   Other proteins in same PDB: d2eeaa2
   automated match to d2d7oa1

Details for d2eeaa1

PDB Entry: 2eea

PDB Description: solution structure of the 17th filamin domain from human filamin-b

PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2eeaa1:

Sequence; same for both SEQRES and ATOM records:

>d2eeaa1 b.1.18.10 (A:8-115) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
pesplqfyvnypnsgsvsaygpglvygvanktatftivtedageggldlaiegpskaeis
cidnkdgtctvtylptlpgdysilvkyndkhipgspftakitddsrrc

Timeline for d2eeaa1:

• d2eeaa1 first appeared in SCOPe 2.04, called d2eeaa_
  
• d2eeaa1 appears in SCOPe 2.06
  
• d2eeaa1 appears in the current release, SCOPe 2.08