Lineage for d2ee9a1 (2ee9 A:8-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765779Protein Filamin b [141025] (1 species)
  7. 2765780Species Human (Homo sapiens) [TaxId:9606] [141026] (17 PDB entries)
    Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192
  8. 2765783Domain d2ee9a1: 2ee9 A:8-95 [241743]
    Other proteins in same PDB: d2ee9a2
    automated match to d2d7pa1

Details for d2ee9a1

PDB Entry: 2ee9 (more details)

PDB Description: solution structure of the 16th filamin domain from human filamin-b
PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2ee9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ee9a1 b.1.18.10 (A:8-95) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
vsdmnglgfkpfdlvipfavrkgeitgevhmpsgktatpeivdnkdgtvtvryaptevgl
hemhikymgshipesplqfyvnypnsgs

SCOPe Domain Coordinates for d2ee9a1:

Click to download the PDB-style file with coordinates for d2ee9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ee9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ee9a2