SCOPe 2.08: Domain d2ee4a1: 2ee4 A:8-209

Lineage for d2ee4a1 (2ee4 A:8-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries)

8. Domain d2ee4a1: 2ee4 A:8-209 [241741]
   Other proteins in same PDB: d2ee4a2
   automated match to d3msxb_

Details for d2ee4a1

PDB Entry: 2ee4

PDB Description: solution structure of the rhogap domain from human rho gtpase activating protein 5 variant

PDB Compounds: (A:) Rho GTPase activating protein 5 variant

SCOPe Domain Sequences for d2ee4a1:

Sequence; same for both SEQRES and ATOM records:

>d2ee4a1 a.116.1.0 (A:8-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wesnyfgmplqdlvtaekpiplfvekcvefiedtglcteglyrvsgnktdqdniqkqfdq
dhninlvsmevtvnavagalkaffadlpdplipyslhpelleaakipdkterlhalkeiv
kkfhpvnydvfryvithlnrvsqqhkinlmtadnlsicfwptlmrpdfenreflsttkih
qsvvetfiqqcqfffyngeive

Timeline for d2ee4a1:

• d2ee4a1 first appeared in SCOPe 2.04, called d2ee4a_
  
• d2ee4a1 appears in SCOPe 2.07