SCOPe 2.08: Domain d2ee2a1: 2ee2 A:8-113

Lineage for d2ee2a1 (2ee2 A:8-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2ee2a1: 2ee2 A:8-113 [241739]
   Other proteins in same PDB: d2ee2a2, d2ee2a3
   automated match to d1wj3a_

Details for d2ee2a1

PDB Entry: 2ee2

PDB Description: solution structures of the fn3 domain of human contactin 1

PDB Compounds: (A:) Contactin-1

SCOPe Domain Sequences for d2ee2a1:

Sequence; same for both SEQRES and ATOM records:

>d2ee2a1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vavinsaqdapseaptevgvkvlssseisvhwehvlekivesyqirywaahdkeeaanrv
qvtsqeysarlenllpdtqyfievgacnsagcgppsdmieaftkka

Timeline for d2ee2a1:

• d2ee2a1 first appeared in SCOPe 2.04, called d2ee2a_
  
• d2ee2a1 appears in SCOPe 2.07