SCOPe 2.06: Domain d2edza1: 2edz A:8-114

Lineage for d2edza1 (2edz A:8-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (13 PDB entries)

8. Domain d2edza1: 2edz A:8-114 [241738]
   Other proteins in same PDB: d2edza2
   automated match to d3ngha_

Details for d2edza1

PDB Entry: 2edz

PDB Description: solution structures of the pdz domain of mus musculus pdz domain- containing protein 1

PDB Compounds: (A:) pdz domain-containing protein 1

SCOPe Domain Sequences for d2edza1:

Sequence; same for both SEQRES and ATOM records:

>d2edza1 b.36.1.0 (A:8-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mastfnprecklskqegqnygfflriekdtdghlirvieegspaekaglldgdrvlring
vfvdkeehaqvvelvrksgnsvtllvldgdsyekavknqvdlkeldq

Timeline for d2edza1:

• d2edza1 first appeared in SCOPe 2.04, called d2edza_
  
• d2edza1 was called d2edza_ in SCOPe 2.05
  
• d2edza1 appears in SCOPe 2.07
  
• d2edza1 appears in the current release, SCOPe 2.08