Lineage for d2ed1a1 (2ed1 A:8-70)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054253Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)
  8. 2054351Domain d2ed1a1: 2ed1 A:8-70 [241723]
    Other proteins in same PDB: d2ed1a2, d2ed1a3
    automated match to d1ugva_

Details for d2ed1a1

PDB Entry: 2ed1 (more details)

PDB Description: solution structure of the sh3 domain of 130 kda phosphatidylinositol 4,5-biphosphate-dependent arf1 gtpase-activating protein
PDB Compounds: (A:) 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein

SCOPe Domain Sequences for d2ed1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ed1a1 b.34.2.0 (A:8-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkvrrvktiydcqadnddeltfiegeviivtgeedqewwighiegqperkgvfpvsfvhi
lsd

SCOPe Domain Coordinates for d2ed1a1:

Click to download the PDB-style file with coordinates for d2ed1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ed1a1: