Class a: All alpha proteins [46456] (289 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries) |
Domain d2ebza1: 2ebz A:8-155 [241719] Other proteins in same PDB: d2ebza2 automated match to d1fqia_ |
PDB Entry: 2ebz (more details)
SCOPe Domain Sequences for d2ebza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebza1 a.91.1.0 (A:8-155) automated matches {Human (Homo sapiens) [TaxId: 9606]} rerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpahdkkelsy rareifskflcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfdsytrflk splyqecilaevegralpdsqqvpsspa
Timeline for d2ebza1: