![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
![]() | Protein automated matches [190464] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries) |
![]() | Domain d2ebza_: 2ebz A: [241719] automated match to d1fqia_ |
PDB Entry: 2ebz (more details)
SCOPe Domain Sequences for d2ebza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebza_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgrerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpah dkkelsyrareifskflcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfd sytrflksplyqecilaevegralpdsqqvpsspa
Timeline for d2ebza_: