SCOPe 2.08: Domain d2ebza1: 2ebz A:8-155

Lineage for d2ebza1 (2ebz A:8-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d2ebza1: 2ebz A:8-155 [241719]
   Other proteins in same PDB: d2ebza2
   automated match to d1fqia_

Details for d2ebza1

PDB Entry: 2ebz

PDB Description: solution structure of the rgs domain from human regulator of g-protein signaling 12 (rgs12)

PDB Compounds: (A:) Regulator of G-protein signaling 12

SCOPe Domain Sequences for d2ebza1:

Sequence; same for both SEQRES and ATOM records:

>d2ebza1 a.91.1.0 (A:8-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpahdkkelsy
rareifskflcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfdsytrflk
splyqecilaevegralpdsqqvpsspa

Timeline for d2ebza1:

• d2ebza1 first appeared in SCOPe 2.04, called d2ebza_
  
• d2ebza1 appears in SCOPe 2.07