SCOPe 2.06: Domain d2ebyb_: 2eby B:

Lineage for d2ebyb_ (2eby B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255139] (1 PDB entry)

8. Domain d2ebyb_: 2eby B: [241718]
   automated match to d4mcxa_
   complexed with so4

Details for d2ebyb_

PDB Entry: 2eby, 2.25 Å

PDB Description: Crystal structure of a hypothetical protein from E. Coli

PDB Compounds: (B:) Putative HTH-type transcriptional regulator ybaQ

SCOPe Domain Sequences for d2ebyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ebyb_ a.35.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
kpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakvfdtt
vdfwlnlqaavdlwevennmrtqeelgrietvaeylar

Timeline for d2ebyb_:

• d2ebyb_ first appeared in SCOPe 2.04
  
• d2ebyb_ appears in SCOPe 2.05
  
• d2ebyb_ appears in SCOPe 2.07
  
• d2ebyb_ appears in the current release, SCOPe 2.08