Lineage for d2ebva1 (2ebv A:8-57)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037334Protein Nuclear pore complex protein nup153 [161175] (2 species)
  7. 3037335Species Human (Homo sapiens) [TaxId:9606] [161176] (2 PDB entries)
    Uniprot P49790 722-750
  8. 3037336Domain d2ebva1: 2ebv A:8-57 [241717]
    Other proteins in same PDB: d2ebva2
    automated match to d3ch5b_
    complexed with zn

Details for d2ebva1

PDB Entry: 2ebv (more details)

PDB Description: solution structure of the third zf-ranbp domain from human nuclear pore complex protein nup153
PDB Compounds: (A:) Nuclear pore complex protein Nup153

SCOPe Domain Sequences for d2ebva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebva1 g.41.11.1 (A:8-57) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]}
ssssctvttgtlgfgdkfkrpigswecsvccvsnnaednkcvscmsekpg

SCOPe Domain Coordinates for d2ebva1:

Click to download the PDB-style file with coordinates for d2ebva1.
(The format of our PDB-style files is described here.)

Timeline for d2ebva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebva2