Lineage for d2ebua_ (2ebu A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1585738Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1585739Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 1585838Family c.15.1.0: automated matches [254228] (1 protein)
    not a true family
  6. 1585839Protein automated matches [254517] (1 species)
    not a true protein
  7. 1585840Species Human (Homo sapiens) [TaxId:9606] [255138] (1 PDB entry)
  8. 1585841Domain d2ebua_: 2ebu A: [241716]
    automated match to d1l7ba_

Details for d2ebua_

PDB Entry: 2ebu (more details)

PDB Description: Solution structure of the BRCT domain from human replication factor C large subunit 1
PDB Compounds: (A:) Replication factor C subunit 1

SCOPe Domain Sequences for d2ebua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebua_ c.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkalgskeipkgaencleglifvitgvlesierdeakslieryggkvtgnvskk
tnylvmgrdsgqsksdkaaalgtkiidedgllnlirtmpgkkskyeiavete

SCOPe Domain Coordinates for d2ebua_:

Click to download the PDB-style file with coordinates for d2ebua_.
(The format of our PDB-style files is described here.)

Timeline for d2ebua_: