Lineage for d2ebta1 (2ebt A:365-457)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639864Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2639865Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2640232Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 2640233Protein automated matches [196455] (4 species)
    not a true protein
  7. 2640238Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)
  8. 2640244Domain d2ebta1: 2ebt A:365-457 [241715]
    Other proteins in same PDB: d2ebta2
    automated match to d2wbsa_
    complexed with zn

Details for d2ebta1

PDB Entry: 2ebt (more details)

PDB Description: solution structure of three tandem repeats of zf-c2h2 domains from human kruppel-like factor 5
PDB Compounds: (A:) Krueppel-like factor 5

SCOPe Domain Sequences for d2ebta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebta1 g.37.1.0 (A:365-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdlekrrihycdypgctkvytksshlkahlrthtgekpykctwegcdwrfarsdeltrhy
rkhtgakpfqcgvcnrsfsrsdhlalhmkrhqn

SCOPe Domain Coordinates for d2ebta1:

Click to download the PDB-style file with coordinates for d2ebta1.
(The format of our PDB-style files is described here.)

Timeline for d2ebta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebta2