SCOPe 2.07: Domain d2ebta1: 2ebt A:365-457

Lineage for d2ebta1 (2ebt A:365-457)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.0: automated matches [196454] (1 protein)
   not a true family

6. Protein automated matches [196455] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255137] (6 PDB entries)

8. Domain d2ebta1: 2ebt A:365-457 [241715]
   Other proteins in same PDB: d2ebta2
   automated match to d2wbsa_
   complexed with zn

Details for d2ebta1

PDB Entry: 2ebt

PDB Description: solution structure of three tandem repeats of zf-c2h2 domains from human kruppel-like factor 5

PDB Compounds: (A:) Krueppel-like factor 5

SCOPe Domain Sequences for d2ebta1:

Sequence; same for both SEQRES and ATOM records:

>d2ebta1 g.37.1.0 (A:365-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdlekrrihycdypgctkvytksshlkahlrthtgekpykctwegcdwrfarsdeltrhy
rkhtgakpfqcgvcnrsfsrsdhlalhmkrhqn

Timeline for d2ebta1:

• d2ebta1 first appeared in SCOPe 2.04, called d2ebta_
  
• d2ebta1 appears in SCOPe 2.06
  
• d2ebta1 appears in the current release, SCOPe 2.08