Lineage for d2ebla1 (2ebl A:8-83)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587296Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2587297Protein automated matches [190463] (8 species)
    not a true protein
  7. 2587329Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)
  8. 2587355Domain d2ebla1: 2ebl A:8-83 [241713]
    Other proteins in same PDB: d2ebla2, d2ebla3
    automated match to d1a6yb_
    complexed with zn

Details for d2ebla1

PDB Entry: 2ebl (more details)

PDB Description: Solution structure of the Zinc finger, C4-type domain of human COUP transcription factor 1
PDB Compounds: (A:) COUP transcription factor 1

SCOPe Domain Sequences for d2ebla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebla1 g.39.1.0 (A:8-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iecvvcgdkssgkhygqftcegcksffkrsvrrnltytcranrncpidqhhrnqcqycrl
kkclkvgmrreavqrg

SCOPe Domain Coordinates for d2ebla1:

Click to download the PDB-style file with coordinates for d2ebla1.
(The format of our PDB-style files is described here.)

Timeline for d2ebla1: