SCOPe 2.08: Domain d2ebla1: 2ebl A:8-83

Lineage for d2ebla1 (2ebl A:8-83)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)

8. Domain d2ebla1: 2ebl A:8-83 [241713]
   Other proteins in same PDB: d2ebla2, d2ebla3
   automated match to d1a6yb_
   complexed with zn

Details for d2ebla1

PDB Entry: 2ebl

PDB Description: solution structure of the zinc finger, c4-type domain of human coup transcription factor 1

PDB Compounds: (A:) COUP transcription factor 1

SCOPe Domain Sequences for d2ebla1:

Sequence; same for both SEQRES and ATOM records:

>d2ebla1 g.39.1.0 (A:8-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iecvvcgdkssgkhygqftcegcksffkrsvrrnltytcranrncpidqhhrnqcqycrl
kkclkvgmrreavqrg

Timeline for d2ebla1:

• d2ebla1 first appeared in SCOPe 2.04, called d2ebla_
  
• d2ebla1 appears in SCOPe 2.07