| Class g: Small proteins [56992] (100 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
| Protein automated matches [190463] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
| Domain d2ebla1: 2ebl A:8-83 [241713] Other proteins in same PDB: d2ebla2, d2ebla3 automated match to d1a6yb_ complexed with zn |
PDB Entry: 2ebl (more details)
SCOPe Domain Sequences for d2ebla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebla1 g.39.1.0 (A:8-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iecvvcgdkssgkhygqftcegcksffkrsvrrnltytcranrncpidqhhrnqcqycrl
kkclkvgmrreavqrg
Timeline for d2ebla1: