SCOPe 2.08: Domain d2eaoa1: 2eao A:8-93

Lineage for d2eaoa1 (2eao A:8-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d2eaoa1: 2eao A:8-93 [241712]
   Other proteins in same PDB: d2eaoa2, d2eaoa3
   automated match to d3h8mb_

Details for d2eaoa1

PDB Entry: 2eao

PDB Description: solution structure of the c-terminal sam-domain of mouse ephrin type-b receptor 1 precursor (ec 2.7.1.112)

PDB Compounds: (A:) Ephrin type-B receptor 1

SCOPe Domain Sequences for d2eaoa1:

Sequence; same for both SEQRES and ATOM records:

>d2eaoa1 a.60.1.0 (A:8-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqplldrsipdftafttvddwlsaikmvqyrdsfltagftslqlvtqmtsedllrigitl
aghqkkilnsihsmrvqisqsptama

Timeline for d2eaoa1:

• d2eaoa1 first appeared in SCOPe 2.04, called d2eaoa_
  
• d2eaoa1 appears in SCOPe 2.07