SCOPe 2.07: Domain d2eama1: 2eam A:8-74

Lineage for d2eama1 (2eam A:8-74)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)

8. Domain d2eama1: 2eam A:8-74 [241710]
   Other proteins in same PDB: d2eama2, d2eama3
   automated match to d1v38a_

Details for d2eama1

PDB Entry: 2eam

PDB Description: Solution structure of the N-terminal SAM-domain of a human putative 47 kDa protein

PDB Compounds: (A:) Putative 47 kDa protein

SCOPe Domain Sequences for d2eama1:

Sequence; same for both SEQRES and ATOM records:

>d2eama1 a.60.1.0 (A:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prcpvqtvgqwlesiglpqyenhlmangfdnvqfmgsnvmedqdlleigilnsghrqril
qaiqllp

Timeline for d2eama1:

• d2eama1 first appeared in SCOPe 2.04, called d2eama_
  
• d2eama1 appears in SCOPe 2.06