Lineage for d2eama1 (2eam A:8-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715571Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2715572Protein automated matches [190031] (3 species)
    not a true protein
  7. 2715581Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2715651Domain d2eama1: 2eam A:8-74 [241710]
    Other proteins in same PDB: d2eama2, d2eama3
    automated match to d1v38a_

Details for d2eama1

PDB Entry: 2eam (more details)

PDB Description: solution structure of the n-terminal sam-domain of a human putative 47 kda protein
PDB Compounds: (A:) Putative 47 kDa protein

SCOPe Domain Sequences for d2eama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eama1 a.60.1.0 (A:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prcpvqtvgqwlesiglpqyenhlmangfdnvqfmgsnvmedqdlleigilnsghrqril
qaiqllp

SCOPe Domain Coordinates for d2eama1:

Click to download the PDB-style file with coordinates for d2eama1.
(The format of our PDB-style files is described here.)

Timeline for d2eama1: