Lineage for d1gbga_ (1gbg A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794633Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (5 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 794634Protein Bacillus 1-3,1-4-beta-glucanase [49926] (4 species)
  7. 794635Species Bacillus licheniformis [TaxId:1402] [49927] (1 PDB entry)
  8. 794636Domain d1gbga_: 1gbg A: [24171]
    complexed with ca

Details for d1gbga_

PDB Entry: 1gbg (more details), 1.8 Å

PDB Description: bacillus licheniformis beta-glucanase
PDB Compounds: (A:) (1,3-1,4)-beta-d-glucan 4 glucanohydrolase

SCOP Domain Sequences for d1gbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbga_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Bacillus licheniformis [TaxId: 1402]}
qtggsfyepfnnyntglwqkadgysngnmfnctwrannvsmtslgemrlsltspsynkfd
cgenrsvqtygyglyevnmkpaknvgivssfftytgptdgtpwdeidieflgkdttkvqf
nyytngvgnhekivnlgfdaansyhtyafdwqpnsikwyvdgqlkhtattqipqtpgkim
mnlwngagvdewlgsyngvtplyahynwvrytkr

SCOP Domain Coordinates for d1gbga_:

Click to download the PDB-style file with coordinates for d1gbga_.
(The format of our PDB-style files is described here.)

Timeline for d1gbga_: