SCOPe 2.04: Domain d2e9ga_: 2e9g A:

Lineage for d2e9ga_ (2e9g A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.0: automated matches [227132] (1 protein)
   not a true family

6. Protein automated matches [226833] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224857] (2 PDB entries)

8. Domain d2e9ga_: 2e9g A: [241707]
   automated match to d1iu1b_

Details for d2e9ga_

PDB Entry: 2e9g

PDB Description: solution structure of the alpha adaptinc2 domain from human adapter- related protein complex 1 gamma 2 subunit

PDB Compounds: (A:) AP-1 complex subunit gamma-2

SCOPe Domain Sequences for d2e9ga_:

Sequence; same for both SEQRES and ATOM records:

>d2e9ga_ b.1.10.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpppapipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficq
aavpkslqlqlqapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeif
evnnlpveswq

Timeline for d2e9ga_:

• d2e9ga_ is new in SCOPe 2.04-stable
  
• d2e9ga_ appears in SCOPe 2.05
  
• d2e9ga_ appears in the current release, SCOPe 2.08, called d2e9ga1