SCOPe 2.08: Domain d2e9ga1: 2e9g A:8-131

Lineage for d2e9ga1 (2e9g A:8-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.0: automated matches [227132] (1 protein)
   not a true family

6. Protein automated matches [226833] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224857] (2 PDB entries)

8. Domain d2e9ga1: 2e9g A:8-131 [241707]
   Other proteins in same PDB: d2e9ga2
   automated match to d1iu1b_

Details for d2e9ga1

PDB Entry: 2e9g

PDB Description: solution structure of the alpha adaptinc2 domain from human adapter- related protein complex 1 gamma 2 subunit

PDB Compounds: (A:) AP-1 complex subunit gamma-2

SCOPe Domain Sequences for d2e9ga1:

Sequence; same for both SEQRES and ATOM records:

>d2e9ga1 b.1.10.0 (A:8-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppapipdlkvferegvqlnlsfirppenpalllititatnfsegdvthficqaavpksl
qlqlqapsgntvpargglpitqlfrilnpnkaplrlklrltydhfhqsvqeifevnnlpv
eswq

Timeline for d2e9ga1:

• d2e9ga1 first appeared in SCOPe 2.04, called d2e9ga_
  
• d2e9ga1 appears in SCOPe 2.07