SCOPe 2.04: Domain d2e8na_: 2e8n A:

Lineage for d2e8na_ (2e8n A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)

8. Domain d2e8na_: 2e8n A: [241706]
   automated match to d1ucva_

Details for d2e8na_

PDB Entry: 2e8n

PDB Description: solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)

PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d2e8na_:

Sequence; same for both SEQRES and ATOM records:

>d2e8na_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgegvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddvkrigvrlpgh
qkriaysllglkdqvntvgipisgpssg

Timeline for d2e8na_:

• d2e8na_ is new in SCOPe 2.04-stable
  
• d2e8na_ appears in SCOPe 2.05
  
• d2e8na_ appears in the current release, SCOPe 2.08, called d2e8na1