SCOPe 2.07: Domain d2e8na1: 2e8n A:8-82

Lineage for d2e8na1 (2e8n A:8-82)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)

8. Domain d2e8na1: 2e8n A:8-82 [241706]
   Other proteins in same PDB: d2e8na2, d2e8na3
   automated match to d1ucva_

Details for d2e8na1

PDB Entry: 2e8n

PDB Description: Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)

PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d2e8na1:

Sequence; same for both SEQRES and ATOM records:

>d2e8na1 a.60.1.0 (A:8-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddvkrigvrlpghqkriays
llglkdqvntvgipi

Timeline for d2e8na1:

• d2e8na1 first appeared in SCOPe 2.04, called d2e8na_
  
• d2e8na1 appears in SCOPe 2.06