Lineage for d2e84a_ (2e84 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012600Family a.138.1.1: Cytochrome c3-like [48696] (5 protein domains)
  6. 2012682Protein automated matches [190934] (3 species)
    not a true protein
  7. 2012683Species Desulfovibrio vulgaris [TaxId:883] [255134] (1 PDB entry)
  8. 2012684Domain d2e84a_: 2e84 A: [241705]
    automated match to d1h29c_
    complexed with hem, na, zn

Details for d2e84a_

PDB Entry: 2e84 (more details), 2.7 Å

PDB Description: crystal structure of high-molecular weight cytochrome c from desulfovibrio vulgaris (miyazaki f) in the presence of zinc ion
PDB Compounds: (A:) high-molecular-weight cytochrome c

SCOPe Domain Sequences for d2e84a_:

Sequence, based on SEQRES records: (download)

>d2e84a_ a.138.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 883]}
kplpgstgeqradlveigvmakfgnlelpkvtfphdrhseavakvaapgkecatchkndd
kgkmslkfmrledttaadlkniyhancigchteqakagkktgpqdgecrschnpkpmass
wkqigldkslhfrhvaakaiapvndpqkncgachhvydeaakklswvknkedscrachgd
arvekkpslreaahtqcitchrsvaaapakadsgpvscagchdpamqakfkvvrdvprle
rgqpdaamvlpvvgpgakdtpkgmkgamkpvafnhkvheaasntcrachhvkidncttch
tlegvkdgnfvqiekamhqpdsmkscvgchnqkvqapacagchgfmktgakpqpeaacgv
chadpvgmdaktvadggllkatkeqradvaaatlaarrttkgtlpaddipefvtigvlsd
kyepsklphrkivntlmaaigddklagtfhtdkatvcagchhnspasktppkcaschgqp
fdaakgdrpglkaayhqqcmgchnrmklekpadtacaechkera

Sequence, based on observed residues (ATOM records): (download)

>d2e84a_ a.138.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 883]}
kplpgstgeqradlveigvmakfgnlelpkvtfphdrhseavakvaapgkecatchkndd
kgkmslkfmrledttaadlkniyhancigchteqakagkktgpqdgecrschnpkpmass
wkqigldkslhfrhvaakaiapvndpqkncgachhvydeaakklswvknkedscrachgd
arvekkpslreaahtqcitchrsvaaapakadsgpvscagchdpamqakfkvvrdvprle
rgqpdaamvlpvvgpgakkgmkgamkpvafnhkvheaasntcrachhvkidncttchtle
gvkdgnfvqiekamhqpdsmkscvgchnqkvqapacagchgfmktgakpqpeaacgvcha
dpvgmdaktvadggllkatkeqradvaaatlaarrttkgtlpaddipefvtigvlsdkye
psklphrkivntlmaaigddklagtfhtdkatvcagchhnspasktppkcaschgqdrpg
lkaayhqqcmgchnrmklepadtacaechkera

SCOPe Domain Coordinates for d2e84a_:

Click to download the PDB-style file with coordinates for d2e84a_.
(The format of our PDB-style files is described here.)

Timeline for d2e84a_: