Lineage for d2e7pd_ (2e7p D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603122Species Populus tremula [TaxId:47664] [188794] (3 PDB entries)
  8. 1603125Domain d2e7pd_: 2e7p D: [241704]
    automated match to d1fova_
    complexed with fes, gsh

Details for d2e7pd_

PDB Entry: 2e7p (more details), 2.1 Å

PDB Description: Crystal structure of the holo form of glutaredoxin C1 from populus tremula x tremuloides
PDB Compounds: (D:) glutaredoxin

SCOPe Domain Sequences for d2e7pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7pd_ c.47.1.0 (D:) automated matches {Populus tremula [TaxId: 47664]}
daalkkakelassapvvvfsktycgycnrvkqlltqvgasykvveldelsdgsqlqsala
hwtgrgtvpnvfiggkqiggcdtvvekhqrnellpllqdaa

SCOPe Domain Coordinates for d2e7pd_:

Click to download the PDB-style file with coordinates for d2e7pd_.
(The format of our PDB-style files is described here.)

Timeline for d2e7pd_: