Lineage for d2e7ka1 (2e7k A:8-85)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2380194Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2380195Protein automated matches [190436] (8 species)
    not a true protein
  7. 2380209Species Human (Homo sapiens) [TaxId:9606] [187333] (99 PDB entries)
  8. 2380362Domain d2e7ka1: 2e7k A:8-85 [241701]
    Other proteins in same PDB: d2e7ka2, d2e7ka3
    automated match to d1kwaa_

Details for d2e7ka1

PDB Entry: 2e7k (more details)

PDB Description: Solution structure of the PDZ domain from Human MAGUK p55 subfamily member 2
PDB Compounds: (A:) MAGUK p55 subfamily member 2

SCOPe Domain Sequences for d2e7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7ka1 b.36.1.0 (A:8-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmvgirktagehlgvtfrveggelviarilhggmvaqqgllhvgdiikevngqpvgsdpr
alqellrnasgsvilkil

SCOPe Domain Coordinates for d2e7ka1:

Click to download the PDB-style file with coordinates for d2e7ka1.
(The format of our PDB-style files is described here.)

Timeline for d2e7ka1: