SCOPe 2.08: Domain d2e7ha1: 2e7h A:8-103

Lineage for d2e7ha1 (2e7h A:8-103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2e7ha1: 2e7h A:8-103 [241700]
   Other proteins in same PDB: d2e7ha2, d2e7ha3
   automated match to d2djsa1

Details for d2e7ha1

PDB Entry: 2e7h

PDB Description: solution structure of the second fn3 domain from human ephrin type-b receptor 4

PDB Compounds: (A:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2e7ha1:

Sequence; same for both SEQRES and ATOM records:

>d2e7ha1 b.1.2.0 (A:8-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppavsdirvtrsspsslslawavprapsgavldyevkyhekgaegpssvrflktsenrae
lrglkrgasylvqvrarseagygpfgqehhsqtqld

Timeline for d2e7ha1:

• d2e7ha1 first appeared in SCOPe 2.04, called d2e7ha_
  
• d2e7ha1 appears in SCOPe 2.07