Lineage for d1viwb_ (1viw B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042199Protein alpha-Amylase inhibitor [49923] (1 species)
  7. 2042200Species French bean (Phaseolus vulgaris) [TaxId:3885] [49924] (1 PDB entry)
  8. 2042201Domain d1viwb_: 1viw B: [24170]
    Other proteins in same PDB: d1viwa1, d1viwa2
    complexed with ca, cl

Details for d1viwb_

PDB Entry: 1viw (more details), 3 Å

PDB Description: tenebrio molitor alpha-amylase-inhibitor complex
PDB Compounds: (B:) alpha-amylase-inhibitor

SCOPe Domain Sequences for d1viwb_:

Sequence, based on SEQRES records: (download)

>d1viwb_ b.29.1.1 (B:) alpha-Amylase inhibitor {French bean (Phaseolus vulgaris) [TaxId: 3885]}
atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
sfdtnftmnirthrqansavgldfvlvpvqpeskgdtvtvefdtflsrisidvnnndiks
vpwdvhdydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfs
atsgayqwsyethdvlswsfsskfi

Sequence, based on observed residues (ATOM records): (download)

>d1viwb_ b.29.1.1 (B:) alpha-Amylase inhibitor {French bean (Phaseolus vulgaris) [TaxId: 3885]}
atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
sfdtnftmnirthrqsavgldfvlvpvqdtvtvefdtflsrisidvnnndiksvpwdvhd
ydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfsatsgayq
wsyethdvlswsfsskfi

SCOPe Domain Coordinates for d1viwb_:

Click to download the PDB-style file with coordinates for d1viwb_.
(The format of our PDB-style files is described here.)

Timeline for d1viwb_: