Lineage for d2e7da_ (2e7d A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376607Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2376653Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2376654Protein automated matches [195426] (7 species)
    not a true protein
  7. 2376673Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)
  8. 2376683Domain d2e7da_: 2e7d A: [241698]
    automated match to d3rtlb_
    complexed with act, gol, so4

Details for d2e7da_

PDB Entry: 2e7d (more details), 2.2 Å

PDB Description: Crystal structure of a NEAT domain from Staphylococcus aureus
PDB Compounds: (A:) Hypothetical protein IsdH

SCOPe Domain Sequences for d2e7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7da_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
dqltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdliveg
krvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdint

SCOPe Domain Coordinates for d2e7da_:

Click to download the PDB-style file with coordinates for d2e7da_.
(The format of our PDB-style files is described here.)

Timeline for d2e7da_: