SCOPe 2.08: Domain d2e6oa1: 2e6o A:8-87

Lineage for d2e6oa1 (2e6o A:8-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189843] (8 PDB entries)

8. Domain d2e6oa1: 2e6o A:8-87 [241695]
   Other proteins in same PDB: d2e6oa2
   automated match to d1o4xb_

Details for d2e6oa1

PDB Entry: 2e6o

PDB Description: solution structure of the hmg box domain from human hmg-box transcription factor 1

PDB Compounds: (A:) HMG box-containing protein 1

SCOPe Domain Sequences for d2e6oa1:

Sequence; same for both SEQRES and ATOM records:

>d2e6oa1 a.21.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtvsatspnkckrpmnafmlfakkyrveytqmypgkdnraisvilgdrwkkmkneerrmy
tleakalaeeqkrlnpdcwk

Timeline for d2e6oa1:

• d2e6oa1 first appeared in SCOPe 2.04, called d2e6oa_
  
• d2e6oa1 appears in SCOPe 2.07