Lineage for d2e65a1 (2e65 A:1-188)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574513Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2574522Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 2574523Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. 2574552Domain d2e65a1: 2e65 A:1-188 [241690]
    Other proteins in same PDB: d2e65a2, d2e65b2
    automated match to d2dxta1
    mutant

Details for d2e65a1

PDB Entry: 2e65 (more details), 1.65 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a
PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2e65a1:

Sequence, based on SEQRES records: (download)

>d2e65a1 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Sequence, based on observed residues (ATOM records): (download)

>d2e65a1 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmgespegglwlsivlsp
kvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegkgdkivlgi
glnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmil

SCOPe Domain Coordinates for d2e65a1:

Click to download the PDB-style file with coordinates for d2e65a1.
(The format of our PDB-style files is described here.)

Timeline for d2e65a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e65a2