SCOPe 2.07: Domain d2e5na1: 2e5n A:8-100

Lineage for d2e5na1 (2e5n A:8-100)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.81: ELL N2 domain-like [158329] (2 protein domains)
   PfamB PB026212; includes recent PDB entry 2e5n
   automatically mapped to Pfam PF10390

6. Protein automated matches [254513] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255129] (1 PDB entry)

8. Domain d2e5na1: 2e5n A:8-100 [241689]
   Other proteins in same PDB: d2e5na2
   automated match to d2doaa1

Details for d2e5na1

PDB Entry: 2e5n

PDB Description: Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2

PDB Compounds: (A:) RNA polymerase II elongation factor ELL2

SCOPe Domain Sequences for d2e5na1:

Sequence; same for both SEQRES and ATOM records:

>d2e5na1 a.4.5.81 (A:8-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tisqrpyrdrvihllalkaykkpellarlqkdgvnqkdknslgailqqvanlnskdlsyt
lkdyvfkelqrdwpgyseidrrslesvlsrkln

Timeline for d2e5na1:

• d2e5na1 first appeared in SCOPe 2.04, called d2e5na_
  
• d2e5na1 appears in SCOPe 2.06