Lineage for d2e5na1 (2e5n A:8-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694506Family a.4.5.81: ELL N2 domain-like [158329] (2 proteins)
    PfamB PB026212; includes recent PDB entry 2e5n
    automatically mapped to Pfam PF10390
  6. 2694510Protein automated matches [254513] (1 species)
    not a true protein
  7. 2694511Species Human (Homo sapiens) [TaxId:9606] [255129] (1 PDB entry)
  8. 2694512Domain d2e5na1: 2e5n A:8-100 [241689]
    Other proteins in same PDB: d2e5na2
    automated match to d2doaa1

Details for d2e5na1

PDB Entry: 2e5n (more details)

PDB Description: solution structure of the ell_n2 domain of target of rna polymerase ii elongation factor ell2
PDB Compounds: (A:) RNA polymerase II elongation factor ELL2

SCOPe Domain Sequences for d2e5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5na1 a.4.5.81 (A:8-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tisqrpyrdrvihllalkaykkpellarlqkdgvnqkdknslgailqqvanlnskdlsyt
lkdyvfkelqrdwpgyseidrrslesvlsrkln

SCOPe Domain Coordinates for d2e5na1:

Click to download the PDB-style file with coordinates for d2e5na1.
(The format of our PDB-style files is described here.)

Timeline for d2e5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e5na2