![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.81: ELL N2 domain-like [158329] (2 proteins) PfamB PB026212; includes recent PDB entry 2e5n automatically mapped to Pfam PF10390 |
![]() | Protein automated matches [254513] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255129] (1 PDB entry) |
![]() | Domain d2e5na1: 2e5n A:8-100 [241689] Other proteins in same PDB: d2e5na2 automated match to d2doaa1 |
PDB Entry: 2e5n (more details)
SCOPe Domain Sequences for d2e5na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5na1 a.4.5.81 (A:8-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} tisqrpyrdrvihllalkaykkpellarlqkdgvnqkdknslgailqqvanlnskdlsyt lkdyvfkelqrdwpgyseidrrslesvlsrkln
Timeline for d2e5na1: