| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (7 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226227] (3 PDB entries) |
| Domain d2e5ia_: 2e5i A: [241688] automated match to d1sjra_ |
PDB Entry: 2e5i (more details)
SCOPe Domain Sequences for d2e5ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5ia_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkritrpgntddpsggnkvlllsiqnplypitvdvlytvcnpvgkvqrivifkr
ngiqamvefesvlcaqkakaalngadiyagcctlkieyarptrlnvirndndswdytkpy
lgrr
Timeline for d2e5ia_: