SCOPe 2.08: Domain d2e5ia1: 2e5i A:200-316

Lineage for d2e5ia1 (2e5i A:200-316)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226227] (6 PDB entries)

8. Domain d2e5ia1: 2e5i A:200-316 [241688]
   Other proteins in same PDB: d2e5ia2
   automated match to d1sjra_

Details for d2e5ia1

PDB Entry: 2e5i

PDB Description: solution structure of rna binding domain 2 in heterogeneous nuclear ribonucleoprotein l-like

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein L-like

SCOPe Domain Sequences for d2e5ia1:

Sequence; same for both SEQRES and ATOM records:

>d2e5ia1 d.58.7.0 (A:200-316) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kritrpgntddpsggnkvlllsiqnplypitvdvlytvcnpvgkvqrivifkrngiqamv
efesvlcaqkakaalngadiyagcctlkieyarptrlnvirndndswdytkpylgrr

Timeline for d2e5ia1:

• d2e5ia1 first appeared in SCOPe 2.04, called d2e5ia_
  
• d2e5ia1 appears in SCOPe 2.07