Lineage for d2e3fa_ (2e3f A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030774Family g.3.7.4: Insect defensins [57163] (6 proteins)
  6. 3030795Protein automated matches [254512] (2 species)
    not a true protein
  7. 3030796Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [255128] (6 PDB entries)
  8. 3030798Domain d2e3fa_: 2e3f A: [241683]
    automated match to d1l4va_
    mutant

Details for d2e3fa_

PDB Entry: 2e3f (more details)

PDB Description: nmr structure of def-bat, a mutant of anopheles defensin def-aaa
PDB Compounds: (A:) defensin, mutant DEF-BAT

SCOPe Domain Sequences for d2e3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3fa_ g.3.7.4 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
atcdlasfssqwvtpndslcaahciarryrggycngkrvcvcr

SCOPe Domain Coordinates for d2e3fa_:

Click to download the PDB-style file with coordinates for d2e3fa_.
(The format of our PDB-style files is described here.)

Timeline for d2e3fa_: