Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.4: Insect defensins [57163] (6 proteins) |
Protein automated matches [254512] (2 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [255128] (6 PDB entries) |
Domain d2e3fa_: 2e3f A: [241683] automated match to d1l4va_ mutant |
PDB Entry: 2e3f (more details)
SCOPe Domain Sequences for d2e3fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e3fa_ g.3.7.4 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} atcdlasfssqwvtpndslcaahciarryrggycngkrvcvcr
Timeline for d2e3fa_: