Lineage for d2dzia1 (2dzi A:8-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933389Domain d2dzia1: 2dzi A:8-81 [241671]
    Other proteins in same PDB: d2dzia2
    automated match to d3dbhi_

Details for d2dzia1

PDB Entry: 2dzi (more details)

PDB Description: 2dzi/solution structure of the n-terminal ubiquitin-like domain in human ubiquitin-like protein 4a (gdx)
PDB Compounds: (A:) Ubiquitin-like protein 4A

SCOPe Domain Sequences for d2dzia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzia1 d.15.1.0 (A:8-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqltvkalqgrecslqvpedelvstlkqlvseklnvpvrqqrllfkgkaladgkrlsdys
igpnsklnlvvkpl

SCOPe Domain Coordinates for d2dzia1:

Click to download the PDB-style file with coordinates for d2dzia1.
(The format of our PDB-style files is described here.)

Timeline for d2dzia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dzia2