Lineage for d1fatd_ (1fat D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042723Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 2042724Species French bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 2042735Domain d1fatd_: 1fat D: [24167]
    complexed with ca, mn, nag

Details for d1fatd_

PDB Entry: 1fat (more details), 2.8 Å

PDB Description: phytohemagglutinin-l
PDB Compounds: (D:) phytohemagglutinin-l

SCOPe Domain Sequences for d1fatd_:

Sequence, based on SEQRES records: (download)

>d1fatd_ b.29.1.1 (D:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

Sequence, based on observed residues (ATOM records): (download)

>d1fatd_ b.29.1.1 (D:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngeprvgslgrafysapiqiwdntt
gtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtvave
fdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvyps
qktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

SCOPe Domain Coordinates for d1fatd_:

Click to download the PDB-style file with coordinates for d1fatd_.
(The format of our PDB-style files is described here.)

Timeline for d1fatd_: