Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (35 species) not a true protein |
Species Geobacillus thermodenitrificans [TaxId:33940] [255125] (1 PDB entry) |
Domain d2dzdb1: 2dzd B:3-120 [241668] Other proteins in same PDB: d2dzda2, d2dzda3, d2dzdb2, d2dzdb3 automated match to d1ulza2 |
PDB Entry: 2dzd (more details), 2.4 Å
SCOPe Domain Sequences for d2dzdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dzdb1 c.30.1.0 (B:3-120) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]} trrirkvlvanrgeiairvfractelgirtvaiyskedvgsyhrykadeaylvgegkkpi eayldiegiieiakahdvdaihpgygflseniqfakrcreegiifigpnenhldmfgd
Timeline for d2dzdb1: