SCOPe 2.04: Domain d2dyda_: 2dyd A:

Lineage for d2dyda_ (2dyd A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.0: automated matches [254226] (1 protein)
   not a true family

6. Protein automated matches [254511] (1 species)
   not a true protein

7. Species Wheat (Triticum aestivum) [TaxId:4565] [255124] (1 PDB entry)

8. Domain d2dyda_: 2dyd A: [241655]
   automated match to d4ivec_

Details for d2dyda_

PDB Entry: 2dyd

PDB Description: solution structure of the pabc domain from triticum aevestium poly(a)- binding protein

PDB Compounds: (A:) poly(A)-binding protein

SCOPe Domain Sequences for d2dyda_:

Sequence; same for both SEQRES and ATOM records:

>d2dyda_ a.144.1.0 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
gplgspigalasalansppetqrmmlgenlyplvdqlehdqaakvtgmllemdqtevlhl
lespdalkakvaeamevlrsaqqht

Timeline for d2dyda_:

• d2dyda_ is new in SCOPe 2.04-stable
  
• d2dyda_ appears in SCOPe 2.05
  
• d2dyda_ appears in the current release, SCOPe 2.08, called d2dyda1