Class a: All alpha proteins [46456] (285 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) |
Family a.144.1.0: automated matches [254226] (1 protein) not a true family |
Protein automated matches [254511] (1 species) not a true protein |
Species Wheat (Triticum aestivum) [TaxId:4565] [255124] (1 PDB entry) |
Domain d2dyda_: 2dyd A: [241655] automated match to d4ivec_ |
PDB Entry: 2dyd (more details)
SCOPe Domain Sequences for d2dyda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyda_ a.144.1.0 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} gplgspigalasalansppetqrmmlgenlyplvdqlehdqaakvtgmllemdqtevlhl lespdalkakvaeamevlrsaqqht
Timeline for d2dyda_: