Lineage for d2dyda1 (2dyd A:6-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734856Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2734889Family a.144.1.0: automated matches [254226] (1 protein)
    not a true family
  6. 2734890Protein automated matches [254511] (2 species)
    not a true protein
  7. 2734894Species Wheat (Triticum aestivum) [TaxId:4565] [255124] (1 PDB entry)
  8. 2734895Domain d2dyda1: 2dyd A:6-85 [241655]
    Other proteins in same PDB: d2dyda2
    automated match to d4ivec_

Details for d2dyda1

PDB Entry: 2dyd (more details)

PDB Description: solution structure of the pabc domain from triticum aevestium poly(a)- binding protein
PDB Compounds: (A:) poly(A)-binding protein

SCOPe Domain Sequences for d2dyda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyda1 a.144.1.0 (A:6-85) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
pigalasalansppetqrmmlgenlyplvdqlehdqaakvtgmllemdqtevlhllespd
alkakvaeamevlrsaqqht

SCOPe Domain Coordinates for d2dyda1:

Click to download the PDB-style file with coordinates for d2dyda1.
(The format of our PDB-style files is described here.)

Timeline for d2dyda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dyda2