![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) ![]() |
![]() | Family a.144.1.0: automated matches [254226] (1 protein) not a true family |
![]() | Protein automated matches [254511] (2 species) not a true protein |
![]() | Species Wheat (Triticum aestivum) [TaxId:4565] [255124] (1 PDB entry) |
![]() | Domain d2dyda1: 2dyd A:6-85 [241655] Other proteins in same PDB: d2dyda2 automated match to d4ivec_ |
PDB Entry: 2dyd (more details)
SCOPe Domain Sequences for d2dyda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyda1 a.144.1.0 (A:6-85) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} pigalasalansppetqrmmlgenlyplvdqlehdqaakvtgmllemdqtevlhllespd alkakvaeamevlrsaqqht
Timeline for d2dyda1: