SCOPe 2.07: Domain d2dyda1: 2dyd A:6-85

Lineage for d2dyda1 (2dyd A:6-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.0: automated matches [254226] (1 protein)
   not a true family

6. Protein automated matches [254511] (1 species)
   not a true protein

7. Species Wheat (Triticum aestivum) [TaxId:4565] [255124] (1 PDB entry)

8. Domain d2dyda1: 2dyd A:6-85 [241655]
   Other proteins in same PDB: d2dyda2
   automated match to d4ivec_

Details for d2dyda1

PDB Entry: 2dyd

PDB Description: Solution structure of the PABC domain from Triticum aevestium poly(A)-binding protein

PDB Compounds: (A:) poly(A)-binding protein

SCOPe Domain Sequences for d2dyda1:

Sequence; same for both SEQRES and ATOM records:

>d2dyda1 a.144.1.0 (A:6-85) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
pigalasalansppetqrmmlgenlyplvdqlehdqaakvtgmllemdqtevlhllespd
alkakvaeamevlrsaqqht

Timeline for d2dyda1:

• d2dyda1 first appeared in SCOPe 2.04, called d2dyda_
  
• d2dyda1 appears in SCOPe 2.06