Lineage for d2dx0b_ (2dx0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965901Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)
  8. 2965905Domain d2dx0b_: 2dx0 B: [241654]
    automated match to d1mila_
    complexed with so4

Details for d2dx0b_

PDB Entry: 2dx0 (more details), 2.5 Å

PDB Description: Crystal structure of the N-terminal SH2 domain of mouse phospholipase C-gamma 2
PDB Compounds: (B:) Phospholipase C, gamma 2

SCOPe Domain Sequences for d2dx0b_:

Sequence, based on SEQRES records: (download)

>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saekllqeycaetgakdgtflvresetfpndytlsfwrsgrvqhcrirstmengvmkyyl
tdnltfnsiyaliqhyreahlrcaefelrltdpvpnp

Sequence, based on observed residues (ATOM records): (download)

>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saekllqeycaetgakdgtflvresetfdytlsfwrsgrvqhcrirstmengvmkyyltd
nltfnsiyaliqhyreahlrcaefelrltdpvpnp

SCOPe Domain Coordinates for d2dx0b_:

Click to download the PDB-style file with coordinates for d2dx0b_.
(The format of our PDB-style files is described here.)

Timeline for d2dx0b_: