SCOPe 2.08: Domain d2dx0b_: 2dx0 B:

Lineage for d2dx0b_ (2dx0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)

8. Domain d2dx0b_: 2dx0 B: [241654]
   automated match to d1mila_
   complexed with so4

Details for d2dx0b_

PDB Entry: 2dx0, 2.5 Å

PDB Description: Crystal structure of the N-terminal SH2 domain of mouse phospholipase C-gamma 2

PDB Compounds: (B:) Phospholipase C, gamma 2

SCOPe Domain Sequences for d2dx0b_:

Sequence, based on SEQRES records:

>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saekllqeycaetgakdgtflvresetfpndytlsfwrsgrvqhcrirstmengvmkyyl
tdnltfnsiyaliqhyreahlrcaefelrltdpvpnp

Sequence, based on observed residues (ATOM records):

>d2dx0b_ d.93.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
saekllqeycaetgakdgtflvresetfdytlsfwrsgrvqhcrirstmengvmkyyltd
nltfnsiyaliqhyreahlrcaefelrltdpvpnp

Timeline for d2dx0b_:

• d2dx0b_ first appeared in SCOPe 2.04
  
• d2dx0b_ appears in SCOPe 2.07