Lineage for d2duwa_ (2duw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847426Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)
  8. 2847435Domain d2duwa_: 2duw A: [241652]
    automated match to d2d59a_

Details for d2duwa_

PDB Entry: 2duw (more details)

PDB Description: solution structure of putative coa-binding protein of klebsiella pneumoniae
PDB Compounds: (A:) putative CoA-binding protein

SCOPe Domain Sequences for d2duwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2duwa_ c.2.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mkendiagiltstrtialvgasdkpdrpsyrvmkylldqgyhvipvspkvagktllgqqg
yatladvpekvdmvdvfrnseaawgvaqeaiaigaktlwlqlgvineqaavlareaglsv
vmdrcpaielprlglak

SCOPe Domain Coordinates for d2duwa_:

Click to download the PDB-style file with coordinates for d2duwa_.
(The format of our PDB-style files is described here.)

Timeline for d2duwa_: