Lineage for d2dtte_ (2dtt E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2967008Species Pyrococcus horikoshii OT3 [TaxId:70601] [255116] (2 PDB entries)
  8. 2967016Domain d2dtte_: 2dtt E: [241650]
    automated match to d2obaa_
    complexed with h4b

Details for d2dtte_

PDB Entry: 2dtt (more details), 2.2 Å

PDB Description: Crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from Pyrococcus horikoshii OT3 complexed with (1'R,2'S)-biopterin
PDB Compounds: (E:) hypothetical protein PH0634

SCOPe Domain Sequences for d2dtte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtte_ d.96.1.0 (E:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mksriivrtsfdaahavkvgdhwedvhghtfflevaiegeikngyvmdflelrkiveeit
keldhrnlnnifenpttenialwigerirdklppyvklkrvvlwegkdngvelew

SCOPe Domain Coordinates for d2dtte_:

Click to download the PDB-style file with coordinates for d2dtte_.
(The format of our PDB-style files is described here.)

Timeline for d2dtte_: