SCOPe 2.06: Domain d2dttc_: 2dtt C:

Lineage for d2dttc_ (2dtt C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (13 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255116] (2 PDB entries)

8. Domain d2dttc_: 2dtt C: [241648]
   automated match to d2obaa_
   complexed with h4b

Details for d2dttc_

PDB Entry: 2dtt, 2.2 Å

PDB Description: Crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from Pyrococcus horikoshii OT3 complexed with (1'R,2'S)-biopterin

PDB Compounds: (C:) hypothetical protein PH0634

SCOPe Domain Sequences for d2dttc_:

Sequence, based on SEQRES records:

>d2dttc_ d.96.1.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mksriivrtsfdaahavkvgdhwedvhghtfflevaiegeikngyvmdflelrkiveeit
keldhrnlnnifenpttenialwigerirdklppyvklkrvvlwegkdngvelew

Sequence, based on observed residues (ATOM records):

>d2dttc_ d.96.1.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mksriivrtsfdaahvhghtfflevaiegeikngyvmdflelrkiveeitkeldhrnlnn
ifenpttenialwigerirdklppyvklkrvvlwegkdngvelew

Timeline for d2dttc_:

• d2dttc_ first appeared in SCOPe 2.04
  
• d2dttc_ appears in SCOPe 2.05
  
• d2dttc_ appears in SCOPe 2.07
  
• d2dttc_ appears in the current release, SCOPe 2.08