SCOPe 2.08: Domain d2ds4a1: 2ds4 A:8-113

Lineage for d2ds4a1 (2ds4 A:8-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)

8. Domain d2ds4a1: 2ds4 A:8-113 [241645]
   Other proteins in same PDB: d2ds4a2
   automated match to d1ksra_

Details for d2ds4a1

PDB Entry: 2ds4

PDB Description: solution structure of the filamin domain from human tripartite motif protein 45

PDB Compounds: (A:) Tripartite motif protein 45

SCOPe Domain Sequences for d2ds4a1:

Sequence; same for both SEQRES and ATOM records:

>d2ds4a1 b.1.18.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evdpakcvlqgedlhrarekqtasftllckdaageimgrggdnvqvavvpkdkkdspvrt
mvqdnkdgtyyisytpkepgvytvwvcikeqhvqgspftvtvrrkh

Timeline for d2ds4a1:

• d2ds4a1 first appeared in SCOPe 2.04, called d2ds4a_
  
• d2ds4a1 appears in SCOPe 2.07