![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein) automatically mapped to Pfam PF02334 |
![]() | Protein Replication terminator protein (RTP) [46808] (1 species) contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer |
![]() | Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries) |
![]() | Domain d2dqrd_: 2dqr D: [241644] automated match to d1bm9a_ mutant |
PDB Entry: 2dqr (more details), 3.01 Å
SCOPe Domain Sequences for d2dqrd_:
Sequence, based on SEQRES records: (download)
>d2dqrd_ a.4.5.7 (D:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]} stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
>d2dqrd_ a.4.5.7 (D:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]} stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd gilkqikvkqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
Timeline for d2dqrd_: